Actress
uncensoredcensoreduncensored leakedamateurheyzo1pondocaribbeancomfc2gvgsddepgdnspsdandyavsaymddnashwaaahmnpppdipxmideroydmkmpmiaahuntcdassmeydatidabwcemdjksraldnsqteluluebwhcawdssisgvhsamassniktrakawdnacrhuntbebodmdbkjuxaukg

DRPT-019

A macho man turned into a slut by tricking him into drinking a protein aphrodisiac during training camp...

Poster
Code
Code Content
Release
2022-07-07
Length
138 min
Actress
Other tags

Related

DRPT-019
censored
DRPT-019
A macho man turned into a slut by tricking him into drinking a protein aphrodisiac during training camp...
2022-07-07 138 min
DRPT-003 [Uncensored Leaked]
uncensored leaked
DRPT-003 [Uncensored Leaked]
A big-assed anal monster is born! Her first anal fuck makes her lose consciousness! Saya Minami
2022-01-13 169 min
DRPT-002 [Uncensored Leaked]
uncensored leaked
DRPT-002 [Uncensored Leaked]
Yui Tenma - After consulting her beloved older brother about her pregnancy, she was made into a sex slave and creampied for three days.
2022-01-13 127 min
DRPT-005 [Uncensored Leaked]
uncensored leaked
DRPT-005 [Uncensored Leaked]
The aphrodisiac she was given worked so well that her vaginal secretions wouldn't stop, making her diaper full and making her embarrassed.
2022-02-10 115 min
DRPT-009 [Uncensored Leaked]
uncensored leaked
DRPT-009 [Uncensored Leaked]
Sensitive married woman Fumi Ayakawa starts going to a beauty salon to improve her post-pregnancy figure, and when her nipples are carefully stimulated, her pent-up breast milk starts gushing out.
2022-03-10 128 min
DRPT-008 [Uncensored Leaked]
uncensored leaked
DRPT-008 [Uncensored Leaked]
A tutor gets angry at his insolent student and pushes him onto the desk to teach him the lesson without expansion...
2022-03-10 114 min
DRPT-014 [Uncensored Leaked]
uncensored leaked
DRPT-014 [Uncensored Leaked]
A wicked groomsman restrains a sports girl brought by her mother and forces her to have anal sex...
2022-05-12 150 min
DRPT-022 [Uncensored Leaked]
uncensored leaked
DRPT-022 [Uncensored Leaked]
Wild sex girl with spread legs tied up and pee sprayed target chain version Nana Maeno, Machi Ikuta, Chiharu Miyazawa
2022-08-11 124 min
DRPT-026 [Uncensored Leaked]
uncensored leaked
DRPT-026 [Uncensored Leaked]
Busty beauty Non Obana gets pinned in front and behind on a crowded train and her nipples are developed
2022-09-08 148 min
DRPT-030 [Uncensored Leaked]
uncensored leaked
DRPT-030 [Uncensored Leaked]
A perverted old man takes her insides naked inside her kappa and gets shaking even though the volunteer cleaner is nearby Minamise Akari
2022-11-10 129 min
DRPT-032 [Uncensored Leaked]
uncensored leaked
DRPT-032 [Uncensored Leaked]
Yuria Yoshine, a busty woman who is tied up naked in a cape at a beauty salon and made to cum over and over again while feeling embarrassed
2022-12-08 147 min
DRPT-071 [Uncensored Leaked]
uncensored leaked
DRPT-071 [Uncensored Leaked]
Judo club's 'sex-processing meat toilet' female manager's recording video during training camp
2024-10-10 138 min
DRPT-070 [Uncensored Leaked]
uncensored leaked
DRPT-070 [Uncensored Leaked]
Beautiful schoolgirl Miogawa Haruka gets bullied on a crowded train and her nipples exposed under her sailor uniform are forcibly developed
2024-10-10 128 min
DRPT-073 [Uncensored Leaked]
uncensored leaked
DRPT-073 [Uncensored Leaked]
A beautiful office lady, Minami Kozue, gets her anus so wide open on a crowded train that she can't close it.
2024-11-07 148 min
DRPT-074 [Uncensored Leaked]
uncensored leaked
DRPT-074 [Uncensored Leaked]
Outdoor Peeing Female Student Chained Spread Legs Restraint Pee Spray 4 Monami Suzu Yukari Nono Tojo Yui
2024-11-07 42 min

JavHD.watch. All trademarks and copyrights on this website are owned by their respective parties. Opinions belong to the posters. 18+ only website. All actors are 18 or older. Watch online the best free JAV. Large collections, best community. Updated daily!

nhdtbiptdibwdvdmsvenxmiababfmiaesdjscjodmiaajuyabwhuntalulucawdhezdocphuntbmukd
Home Category Actress